General Information

  • ID:  hor002065
  • Uniprot ID:  P80090
  • Protein name:  Molluscan insulin-related peptide 3 B chain
  • Gene name:  NA
  • Organism:  Lymnaea stagnalis (Great pond snail) (Helix stagnalis)
  • Family:  Insulin family
  • Source:  Animal
  • Expression:  Expressed in the cerebral light-green cells which are giant neuroendocrines cells involved in the control of growth.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Lymnaea (genus), Lymnaeidae (family), Lymnaeoidea (superfamily), Hygrophila, Panpulmonata, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0030133 transport vesicle; GO:0031410 cytoplasmic vesicle

Sequence Information

  • Sequence:  TTQHTCSILSRPHPRGLCGSTLANMVQWLCSTYTTSS
  • Length:  37(30-66)
  • Propeptide:  MASVHLTLTKAFMVTVFLTLLLNVSITRGTTQHTCSILSRPHPRGLCGSTLANMVQWLCSTYTTSSKVKRQAEPDEEDDAMSKIMISKKRALSYLTKRESRPSIVCECCFNQCTVQELLAYC
  • Signal peptide:  MASVHLTLTKAFMVTVFLTLLLNVSITRG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P80090-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002065_AF2.pdbhor002065_ESM.pdb

Physical Information

Mass: 468188 Formula: C170H273N51O55S4
Absent amino acids: DEFK Common amino acids: T
pI: 8.52 Basic residues: 4
Polar residues: 20 Hydrophobic residues: 8
Hydrophobicity: -18.11 Boman Index: -5456
Half-Life / Aliphatic Index: 7.2 hour Aliphatic Index: 63.24
Instability Index: 2240.54 Extinction Coefficient cystines: 7115
Absorbance 280nm: 197.64

Literature

  • PubMed ID:  1572366
  • Title:  Isolation and chemical characterization of a novel insulin-related neuropeptide from the freshwater snail, Lymnaea stagnalis.